Skip to Content
-
Sort By: Featured
Recombinant Mouse XEDAR/EDA2R Protein His Tag , 10ug
200.40 € 200.4 EUR
Recombinant Mouse Tmem27 aa. Ile12~Leu222 fused with Nsize:terminal His & GST tag was produced in E. coli cells, 100 µg
718.00 € 718.0 EUR
Recombinant Mouse TIMsize:3/HAVCR2 Protein aa 20size:191, His Tag
485.60 € 485.6 EUR
Recombinant Mouse TGFBR2, hIgG1 Fcsize:tagged, 1mg
8,088.00 € 8088.0 EUR
Recombinant Mouse TGFBR2, hIgG1 Fcsize:tagged, 0.5mg
4,408.00 € 4408.0 EUR
Recombinant Mouse Semaphorinsize:4D/SEMA4D Protein Fc Tag , 50 ug
619.00 € 619.0 EUR
Recombinant Mouse Msize:CSF/CSF1 Protein His Tag size: 10ug
200.00 € 200.0 EUR
Recombinant Mouse Interleukinsize:12/ILsize:12 size: 10ug
460.00 € 460.0 EUR
Recombinant Mouse ILsize:34 protein His Tag , 100 µg
739.00 € 739.0 EUR
Recombinant Mouse GDF11/BMPsize:11 protein His tag size: 100µg
500.00 € 500.0 EUR
Recombinant Mouse Corticosteroid 11size:betasize:dehydrogenase isozyme 1 Hsd11b1 ,partial
1,200.00 € 1200.0 EUR
Recombinant Mouse Corin CRN ,50ug
798.00 € 798.0 EUR
Recombinant Mouse Cathepsin S Ctss size: 20ug
460.00 € 460.0 EUR
Recombinant Mouse Carboxylesterase 1C 0.1MG Ecoli
729.00 € 729.0 EUR
Recombinant Mouse Csize:C chemokine receptor type 8 Ccr8 size: 20 ug
1,793.00 € 1793.0 EUR
Recombinant Mouse Csize:C chemokine receptor type 8 Ccr8 size: 100 µg
2,766.00 € 2766.0 EUR
Recombinant Mouse Apolipoprotein E Apoe , 100 µg
578.00 € 578.0 EUR
Recombinant Mouse Apolipoprotein E Apoe 20ug
391.00 € 391.0 EUR
Recombinant Mouse Apolipoprotein E Apoe 1mg
2,466.00 € 2466.0 EUR
Recombinant Mouse Antisize:Monkey IgG Antibody clone TB109a , 1 MG
2,539.00 € 2539.0 EUR
Recombinant Mouse 11size:betasize:hydroxysteroid dehydrogenase 1 Hsd11b1 size: E.coli 100 µg
2,644.00 € 2644.0 EUR
Recombinant Malus domestica Nonsize:specific lipidsize:transfer protein MALD3 20ug
388.00 € 388.0 EUR
Recombinant Malus domestica Major allergen Mal d 1 MALD1 size:E.colisize:100 µg
840.00 € 840.0 EUR
Recombinant Malus domestica Major allergen Mal d 1 MALD1 20ug
388.00 € 388.0 EUR
Recombinant Malus domestica Major allergen Mal d 1 MALD1 size: MBS1224919 size: 0.02 mg Esize:Coli
648.00 € 648.0 EUR
Recombinant Malus domestica Apple Pyrus malus Nonsize:specific lipidsize:transfer protein size: MBS1327013 size: 0.02 mg Esize:Coli
648.00 € 648.0 EUR
Recombinant Macaca fascicularis CD93 molecule CD93 , 100 µg
557.00 € 557.0 EUR
• R0253C
0.00 € 0.0 EUR
• HiPurA® Blood Genomic DNA Miniprep Purification Kit size: 50 preps
275.00 € 275.0 EUR
• HiPer® Western Blotting Teaching Kit size: 50 preps
806.00 € 806.0 EUR
Еndothelial Cell Growth Supplement ECGS size: 500X
204.00 € 204.0 EUR
Доставка
0.00 € 0.0 EUR
ДДС 20%
0.00 € 0.0 EUR
ωsize:agatoxinsize:IVA, 0,5 mg
975.00 € 975.0 EUR
ωsize:Conotoxinsize:GVIA, 0.5 mg
449.00 € 449.0 EUR
δsize:1,2,3,4,5,6size:Hexachlorocyclohexane size: 1 g
7,700.00 € 7700.0 EUR
γsize:[Ethylsize:CONHsize: PEG4 ]size:ATPsize:Biotin size: 50ul
310.00 € 310.0 EUR
γsize:[ 8size:Aminooctyl size:imido]size:ATP size: 5 x 100ul
542.00 € 542.0 EUR
γsize:PEG8size:ATPsize:Biotin size: 50ul
310.00 € 310.0 EUR
γsize:Aminobutyric Acid GABA Colorimetric Assay Kit
430.00 € 430.0 EUR
γsize: 6size:Azidohexyl size:ATP 5 x 50 μl 10 mM
433.00 € 433.0 EUR
γsize: 6size:Aminohexyl size:ATPsize:Cy5 size: 160 ul
1,289.00 € 1289.0 EUR
γsize: 6size:Aminohexyl size:ATPsize:Biotin size: 50ul
388.00 € 388.0 EUR
γsize: 6size:Aminohexyl size:ATPsize:ATTOsize:647N size: 120 µL
1,195.00 € 1195.0 EUR
γsize: 2size:Azidoethyl size:ATP 5 x 100 μl 10 mM
433.56 € 433.56 EUR
βsize:Hexosaminidase Activity Assay size: 100 Tests
450.00 € 450.0 EUR
βsize:HCG size: 96 Tests/box
62.00 € 62.0 EUR
βsize:Glucan Assay Kit Mixed Linkage size: 100 assays
600.00 € 600.0 EUR
βsize:Galactosidase from Escherichia coli size: 1000 units
246.00 € 246.0 EUR
βsize:Galactosidase Staining Kit size: 1 kit
582.00 € 582.0 EUR
βsize:Casomorphin bovine size: 5mg
420.00 € 420.0 EUR
βsize:Amyloid 1size:42 , rat/mouse TFA , 10 mg
1,429.00 € 1429.0 EUR
αsize:MEM with Lsize:Gln, Ribonucleosides and Deoxyribonucleosides, liquid size: 500 mL
221.50 € 221.5 EUR
αsize:Bungarotoxin, CF® Dye and Other Conjugates CF488A, 0.5mg
749.00 € 749.0 EUR
αsize:Amylase Activity Assay Kit size: 96T
375.00 € 375.0 EUR
αsize:Amylase Activity Assay size: 100 Assays
430.00 € 430.0 EUR
°BMPS CAS N°55750size:62size:4 size: 100 mG
153.00 € 153.0 EUR
ylated Human FcRn / FCGRT&B2M Heterodimer Protein, His,Avitag MALS & SPR verified size: 200ug
1,800.00 € 1800.0 EUR
xylA recombinant protein :: Xylose isomerase xylA Recombinant Protein size: 1 mg Esize:Coli
2,600.00 € 2600.0 EUR
watersafe WS425B
40.00 € 40.0 EUR
van eyck
1.00 € 1.0 EUR
v
1.00 € 1.0 EUR
transport gratis
0.00 € 0.0 EUR
transsize:ISRIB, 10 mg
339.00 € 339.0 EUR
total collagen assay kit 2x 96size:assays
820.00 € 820.0 EUR
tissuesize:tek Xpress X120 Processing Reagent Set size: 4 x 3.8 L
1,123.00 € 1123.0 EUR
tdTomato Goat Polyclonal Antibody, 600 µg
442.00 € 442.0 EUR
tTG recombinant protein size: 5x1 mg
5,523.00 € 5523.0 EUR
tTG recombinant protein size: 1 mg
1,279.00 € 1279.0 EUR
tTG recombinant protein size: 0.1 mg
463.00 € 463.0 EUR
tDenHybsize:2 For tissue FISH with unique sequence probes size: 1mL
388.41 € 388.41 EUR
tDenHybsize:1 For general tissue FISH size: 1 mL
279.00 € 279.0 EUR
synomag®size:D streptavidin, 70 nm, 5 mg/ml size: 2 ml
473.00 € 473.0 EUR
synomag®size:D streptavidin, 50 nm, 5 mg/ml size: 2ml
473.00 € 473.0 EUR
sulfo Cyanine5 azide size: 1 mg
191.00 € 191.0 EUR
stomer service:Sequence , MEKLSEQELAKVSGGFPLLPIVVPIIAGGATYVAKDAWNHLDQIRSGWRKAGNSKW, 90% purity, 3 MG
926.00 € 926.0 EUR
sspB recombinant protein :: Stringent starvation protein B sspB Recombinant Protein Esize:Coli size: 1 mg
1,980.00 € 1980.0 EUR
soluble epoxide hydrolase: ~100 U/mg size: 50 µg
2,200.00 € 2200.0 EUR
shp53 pLKO.1 puro Plasmid, 2 ug
335.40 € 335.4 EUR
shipping
0.00 € 0.0 EUR
sRAGE elisa kit :: Rat sRAGE Solube Receptor for Advanced Glycation End product ELISA Kit size: 96size:Stripsize:Wells
1,210.00 € 1210.0 EUR
sPsize:Sel elisa kit :: Bovine soluble Psize:selectin sPsize:Sel ELISA Kit, 96 tests
706.00 € 706.0 EUR
sICAMsize:1 elisa kit :: Guinea Pig sICAMsize:1 ELISA Kitsize:96size:Stripsize:Wells
810.00 € 810.0 EUR
sAPPbsize:Wild Type high sensitive ELISA
1,444.30 € 1444.3 EUR
sAPPa high sensitive ELISA
1,444.30 € 1444.3 EUR
rgpB Antibody size: 50 µg
483.00 € 483.0 EUR
rgpB Antibody size: 100 µg
425.00 € 425.0 EUR
rgpA Antibody, 50 µg
289.00 € 289.0 EUR
rg18901dd
1.00 € 1.0 EUR
rat antisize:mouse Lgi4IgG1 KT18 antibody, 0.2 mg
508.00 € 508.0 EUR
rsize:KSTI, 1 mg
167.70 € 167.7 EUR
qPCR Probe Master Mix size: 500 reactions
241.00 € 241.0 EUR
qPCR Probe Master Mix size: 2500 reactions
1,087.00 € 1087.0 EUR
qPCR Lentivirus Titration kit size: 100 reactions
230.00 € 230.0 EUR
qPCR AAV Titer Kit size: 100 Reactions
257.00 € 257.0 EUR
pvt2304
0.00 € 0.0 EUR
proDynorphin size: 50 ul
560.00 € 560.0 EUR
pmCherrysize: C1 plasmid size: 2 ug
462.00 € 462.0 EUR
pk 401
1.00 € 1.0 EUR
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.